McDonnell Genome Institute

Washington University

Transcript

VIM-AS1:5

Chromosome

chr10

Gene Name

VIM-AS1

Start

17214238

CPC Label

noncoding

End

17226898

Cancer

BRCA-Basal-like

Strand

-

Peptide

IDSIDISKK

Modified Peptide

n[145]IDSIDISKK

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

LFPQKIYFLKIFTQDCCENKIDSIDISKKKYIFKK

Conservation Score

0.419

PhyloCSF Frame 1

-5.602

No. of Spectra

2

CPC Coding Probability

0.0166715

PhyloCSF Frame 2 

-6.327

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

-5.397

CNTI Score

-0.405179094