McDonnell Genome Institute

Washington University

Transcript

VAV3-AS1:4

Chromosome

chr1

Gene Name

VAV3-AS1

Start

107964054

CPC Label

noncoding

End

108006089

Cancer

BRCA-Luminal B

Strand

+

Peptide

GGQITQGQEIK

Modified Peptide

n[145]GGQITQGQEIK

Peptide Length

11

ORF Length

41

Open Reading Frame (ORF)

LGLGAGARTYNPSTFGGRGGQITQGQEIKNSLPNMVKPRLH

Conservation Score

0.019

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0945516

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9317

PhyloCSF Frame 3

0

CNTI Score

-0.337422049