McDonnell Genome Institute

Washington University

Transcript

UVRAG-DT:21

Chromosome

chr11

Gene Name

UVRAG-DT

Start

75800876

CPC Label

noncoding

End

75814777

Cancer

BRCA-Basal-like

Strand

-

Peptide

RWHLVIAR

Modified Peptide

n[145]RWHLVIAR

Peptide Length

8

ORF Length

37

Open Reading Frame (ORF)

LNRKELEKRWHLVIARVTAGQASAFLVELRPGAGNTA

Conservation Score

0.116

PhyloCSF Frame 1

-4.188

No. of Spectra

9

CPC Coding Probability

0.0596487

PhyloCSF Frame 2 

-4.888

CNTI Index

noncoding

Max Probability

0.9481

PhyloCSF Frame 3

-3.351

CNTI Score

-0.319131265