McDonnell Genome Institute

Washington University

Transcript

UVRAG-DT:19

Chromosome

chr11

Gene Name

UVRAG-DT

Start

75800876

CPC Label

noncoding

End

75814777

Cancer

PRAD

Strand

-

Peptide

HLTHCLGDSTFLINTSCHYFHMSYFILK

Modified Peptide

HLTHCLGDSTFLINTSCHYFHM[147]SYFILK

Peptide Length

28

ORF Length

43

Open Reading Frame (ORF)

LQSIQDDVKHLTHCLGDSTFLINTSCHYFHMSYFILKTFLSCF

Conservation Score

0.62

PhyloCSF Frame 1

-5.39

No. of Spectra

7

CPC Coding Probability

0.0320498

PhyloCSF Frame 2 

-5.569

CNTI Index

noncoding

Max Probability

0.9569

PhyloCSF Frame 3

-5.524

CNTI Score

-0.33916508