McDonnell Genome Institute

Washington University

Transcript

USP46-AS1:4

Chromosome

chr4

Gene Name

USP46-AS1

Start

52659429

CPC Label

noncoding

End

52666359

Cancer

OV

Strand

+

Peptide

MIDLPAACILHLEKPQALNCSP

Modified Peptide

n[145]M[147]IDLPAACILHLEKPQALNCSP

Peptide Length

22

ORF Length

49

Open Reading Frame (ORF)

LEAPTGSPLGHCLMELYEVGHCPPDLRMIDLPAACILHLEKPQALNCSP

Conservation Score

0.16

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.106998

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8669

PhyloCSF Frame 3

0

CNTI Score

-0.302324673