McDonnell Genome Institute

Washington University

Transcript

USP46-AS1:13

Chromosome

chr4

Gene Name

USP46-AS1

Start

52659536

CPC Label

noncoding

End

52668763

Cancer

OV

Strand

+

Peptide

GDVPVPR

Modified Peptide

n[145]GDVPVPR

Peptide Length

7

ORF Length

59

Open Reading Frame (ORF)

MGRGHRSGQRALASCGPGARERAPGRGRNPGLGGGQQRRARAACDISGSKGDVPVPRKH

Conservation Score

0.994

PhyloCSF Frame 1

-0.528

No. of Spectra

10

CPC Coding Probability

0.187309

PhyloCSF Frame 2 

-3.961

CNTI Index

coding

Max Probability

0.7552

PhyloCSF Frame 3

-3.341

CNTI Score

0.703332213