McDonnell Genome Institute

Washington University

Transcript

USP46-AS1:11

Chromosome

chr4

Gene Name

USP46-AS1

Start

52659438

CPC Label

noncoding

End

52668763

Cancer

OSCC

Strand

+

Peptide

VEINTQHPK

Modified Peptide

n[145]VEINTQHPK

Peptide Length

9

ORF Length

46

Open Reading Frame (ORF)

LSLKLNESIFLKKKVEINTQHPKSQRVFQDGGNSQMYQIQPSDQGR

Conservation Score

0.233

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.143978

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9206

PhyloCSF Frame 3

0

CNTI Score

-0.302324673