McDonnell Genome Institute

Washington University

Transcript

USP2-AS1:8

Chromosome

chr11

Gene Name

USP2-AS1

Start

119381809

CPC Label

coding

End

119500595

Cancer

OV

Strand

+

Peptide

TQEDSALSSCANPHCPQK

Modified Peptide

n[145]TQEDSALSSCANPHCPQK

Peptide Length

18

ORF Length

69

Open Reading Frame (ORF)

LDSFPMELTTHGRGREIQAHRKTQEDSALSSCANPHCPQKEERHTALPSRWNPGRIEVLKTHHLFACKL

Conservation Score

0.042

PhyloCSF Frame 1

-4.356

No. of Spectra

4

CPC Coding Probability

0.71463

PhyloCSF Frame 2 

-4.114

CNTI Index

noncoding

Max Probability

0.8453

PhyloCSF Frame 3

-2.373

CNTI Score

-0.363664662