McDonnell Genome Institute

Washington University

Transcript

UGDH-AS1:3

Chromosome

chr4

Gene Name

UGDH-AS1

Start

39528018

CPC Label

noncoding

End

39594707

Cancer

EOGC

Strand

+

Peptide

GDITTNPTEIQTIIR

Modified Peptide

n[145]GDITTNPTEIQTIIR

Peptide Length

15

ORF Length

191

Open Reading Frame (ORF)

LFSLKREKNQIDAIKNDKGDITTNPTEIQTIIREYYKRLYAKKLENLEEMVKFLDTYTLPRLNQEEVDSLNRPITGSEIVAIINSLPTKKSPGPDGFTAEFYQRYKEELVPFLLKLFQSIEKEGILPNSFYEASIILIPKPGRDTTKKENFRPISLMNIDAKILNKILANQIQQHIKKLIHHDQVGFIPGM

Conservation Score

0.446

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.316476

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5174

PhyloCSF Frame 3

0

CNTI Score

-0.305096872