McDonnell Genome Institute

Washington University

Transcript

UCHL1-AS1:1

Chromosome

chr4

Gene Name

UCHL1-AS1

Start

41220073

CPC Label

noncoding

End

41256727

Cancer

CCRC

Strand

-

Peptide

VSEAFEK

Modified Peptide

n[230]VSEAFEK

Peptide Length

7

ORF Length

83

Open Reading Frame (ORF)

LMESLILGEVSGNPSFHHPNYSKARVSEAFEKKHKFNRYLSSVFSVMWLKIGIYSMATKNDTTSNCTMCEVLQKHMASSGIKK

Conservation Score

1

PhyloCSF Frame 1

-2.943

No. of Spectra

2

CPC Coding Probability

0.098008

PhyloCSF Frame 2 

-2.991

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

-2.153

CNTI Score

-0.399180756