McDonnell Genome Institute

Washington University

Transcript

UCA1:7

Chromosome

chr19

Gene Name

UCA1

Start

15834499

CPC Label

noncoding

End

15837766

Cancer

OSCC

Strand

+

Peptide

TEGRAAPGELGSQTPESQRTGPGPATAR

Modified Peptide

n[145]TEGRAAPGELGSQTPESQRTGPGPATAR

Peptide Length

28

ORF Length

204

Open Reading Frame (ORF)

LRTMWIAVETLALENAGRETFITRFTASPRGSEAGGPGRGDPASHTFWKTQGEAGAAFGGKGGTGEPTGHGSSHRIPRPEAGSPHDPPVAPAQSGEMRSCPERALGRQSLRRDRTGLPESQLPAQPHPAAERTEGRAAPGELGSQTPESQRTGPGPATARSGWFHQLLLRSRDVRPRTLSISGFRVSRRPPLGLLTSQRGGDGD

Conservation Score

0.217

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.387592

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8791

PhyloCSF Frame 3

0

CNTI Score

-0.281029151