McDonnell Genome Institute

Washington University

Transcript

UBR5-AS1:5

Chromosome

chr8

Gene Name

UBR5-AS1

Start

102239393

CPC Label

noncoding

End

102253378

Cancer

OV

Strand

+

Peptide

VLFDASDFLAGGVVMR

Modified Peptide

n[145]VLFDASDFLAGGVVM[147]R

Peptide Length

16

ORF Length

78

Open Reading Frame (ORF)

LVRMWGGERVEGLYHLNLNVTVRVLFDASDFLAGGVVMRTIVRMSKTAQQVEGGASTHFSFGELLEPDSSYNCIYNQL

Conservation Score

0.737

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0631669

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9103

PhyloCSF Frame 3

0

CNTI Score

0.675529445