McDonnell Genome Institute

Washington University

Transcript

UBAC2-AS1:10

Chromosome

chr13

Gene Name

UBAC2-AS1

Start

99186806

CPC Label

noncoding

End

99200674

Cancer

OV

Strand

-

Peptide

SLALPSWSAVAR

Modified Peptide

n[145]SLALPSWSAVAR

Peptide Length

12

ORF Length

42

Open Reading Frame (ORF)

LFCSFVLRRSLALPSWSAVARSRLTDTSASPVQAILLPQPPK

Conservation Score

0.341

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.409851

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8845

PhyloCSF Frame 3

0

CNTI Score

0.71207838