McDonnell Genome Institute

Washington University

Transcript

TUSC8:10

Chromosome

chr13

Gene Name

TUSC8

Start

44397724

CPC Label

noncoding

End

44405973

Cancer

OV

Strand

-

Peptide

ASIGGLGGMLVWALREK

Modified Peptide

n[145]ASIGGLGGM[147]LVWALREK

Peptide Length

17

ORF Length

44

Open Reading Frame (ORF)

MASIGGLGGMLVWALREKEKVCTLIKSRQCGSWKETHGNTDPVT

Conservation Score

0.015

PhyloCSF Frame 1

-4.094

No. of Spectra

4

CPC Coding Probability

0.0928486

PhyloCSF Frame 2 

-5.433

CNTI Index

noncoding

Max Probability

0.4649

PhyloCSF Frame 3

-2.723

CNTI Score

-0.304606504