McDonnell Genome Institute

Washington University

Transcript

TUG1:24

Chromosome

chr22

Gene Name

TUG1

Start

30971366

CPC Label

noncoding

End

30978845

Cancer

CCRC

Strand

+

Peptide

LYQFNLAK

Modified Peptide

n[43]LYQFNLAK

Peptide Length

8

ORF Length

33

Open Reading Frame (ORF)

LYQFNLAKEEKFPLYLKFTADSNCLTELFDVEG

Conservation Score

1

PhyloCSF Frame 1

-4.065

No. of Spectra

8

CPC Coding Probability

0.310205

PhyloCSF Frame 2 

-5.056

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

-4.78

CNTI Score

-0.36772923