McDonnell Genome Institute

Washington University

Transcript

TTTY15:1

Chromosome

chrY

Gene Name

TTTY15

Start

12662333

CPC Label

noncoding

End

12690441

Cancer

EOGC

Strand

+

Peptide

LPLSYLGR

Modified Peptide

n[145]LPLSYLGR

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

LPLSYLGRLPERLVLVSGPGDRSVSGETWPKTARKKSEA

Conservation Score

0.614

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.00605421

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2942

PhyloCSF Frame 3

0

CNTI Score

-0.347757933