McDonnell Genome Institute

Washington University

Transcript

TTTY14:6

Chromosome

chrY

Gene Name

TTTY14

Start

18932698

CPC Label

noncoding

End

19077416

Cancer

OV

Strand

-

Peptide

GAVQSSNPSLVACMFSPSYTAGR

Modified Peptide

n[145]GAVQSSNPSLVACM[147]FSPSYTAGR

Peptide Length

23

ORF Length

48

Open Reading Frame (ORF)

MGSARAPPLSRRGAVQSSNPSLVACMFSPSYTAGRLRLKEYLSPGIQD

Conservation Score

0.996

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0233504

PhyloCSF Frame 2 

1.134

CNTI Index

noncoding

Max Probability

0.9572

PhyloCSF Frame 3

0.068

CNTI Score

-0.274707594