McDonnell Genome Institute

Washington University

Transcript

TTC39A-AS1:7

Chromosome

chr1

Gene Name

TTC39A-AS1

Start

51329672

CPC Label

noncoding

End

51354342

Cancer

CCRC

Strand

+

Peptide

GAQASLAAK

Modified Peptide

n[230]GAQASLAAK

Peptide Length

9

ORF Length

51

Open Reading Frame (ORF)

LIKDINLKNVSMRGAQASLAAKIKRRLRERRYPTTSKGGVMFNQLWALQAL

Conservation Score

0.481

PhyloCSF Frame 1

-5.166

No. of Spectra

3

CPC Coding Probability

0.389096

PhyloCSF Frame 2 

-4.606

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

-3.686

CNTI Score

-0.335482023