McDonnell Genome Institute

Washington University

Transcript

TTC28-AS1:37

Chromosome

chr22

Gene Name

TTC28-AS1

Start

27919499

CPC Label

noncoding

End

27997631

Cancer

OV

Strand

+

Peptide

TDDQPWLSLR

Modified Peptide

n[145]TDDQPWLSLR

Peptide Length

10

ORF Length

104

Open Reading Frame (ORF)

MPELRHPRQEEVCTHTSQEETSLPGRTDDQPWLSLRSGGPPRHTAHWVKEYPGGVRSMTHLPGTSTWGCQAATPAAVLTGPGRGTDPPLENDTSNIRMCQLDLC

Conservation Score

0.876

PhyloCSF Frame 1

-4.01

No. of Spectra

1

CPC Coding Probability

0.426781

PhyloCSF Frame 2 

-2.986

CNTI Index

noncoding

Max Probability

0.9492

PhyloCSF Frame 3

-3.33

CNTI Score

-0.369311256