McDonnell Genome Institute

Washington University

Transcript

TTC28-AS1:1

Chromosome

chr22

Gene Name

TTC28-AS1

Start

27919367

CPC Label

noncoding

End

27925396

Cancer

HCC

Strand

+

Peptide

LNFFCIWWRR

Modified Peptide

LNFFCIWWRR

Peptide Length

10

ORF Length

119

Open Reading Frame (ORF)

LASQSAGITGVSHRARPCFFFFLSFFFFFFETGVLLLLPRLECNGTISAYCNLRLPSSSCSPASASRVTGITGTCHHARLNFFCIWWRRGFTMLVRLILNARPQVIQPPWPPEVLGLQV

Conservation Score

0.3

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0658835

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4219

PhyloCSF Frame 3

0

CNTI Score

-0.348809533