McDonnell Genome Institute

Washington University

Transcript

TSPOAP1-AS1:39

Chromosome

chr17

Gene Name

TSPOAP1-AS1

Start

58324560

CPC Label

noncoding

End

58345173

Cancer

PRAD

Strand

+

Peptide

LGGQVAR

Modified Peptide

‚Äč

Peptide Length

7

ORF Length

60

Open Reading Frame (ORF)

LGGQVARRVSPAADGLPSPFLQSLLSSQMGEGWPPRPGTQQQQQLTALEPLKSDSTRKCV

Conservation Score

1

PhyloCSF Frame 1

-2.044

No. of Spectra

51

CPC Coding Probability

0.0833844

PhyloCSF Frame 2 

-1.75

CNTI Index

noncoding

Max Probability

0.996

PhyloCSF Frame 3

-1.809

CNTI Score

-0.33294941