McDonnell Genome Institute

Washington University

Transcript

TSPEAR-AS2:4

Chromosome

chr21

Gene Name

TSPEAR-AS2

Start

44517616

CPC Label

noncoding

End

44520830

Cancer

HCC

Strand

+

Peptide

SPSHPFVAAR

Modified Peptide

n[230]SPSHPFVAAR

Peptide Length

10

ORF Length

48

Open Reading Frame (ORF)

MTGVEPRVFPRELLSAGLLCSAAVPKSPSHPFVAARCHHLLLLFFFCF

Conservation Score

0.028

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.229776

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

0

CNTI Score

-0.312522161