McDonnell Genome Institute

Washington University

Transcript

TSIX:1

Chromosome

chrX

Gene Name

TSIX

Start

73792204

CPC Label

noncoding

End

73829231

Cancer

OV

Strand

+

Peptide

MISYWNCMK

Modified Peptide

n[145]M[147]ISYWNCMK

Peptide Length

9

ORF Length

35

Open Reading Frame (ORF)

MISYWNCMKLNNLNLELVMFLRPIQNKGRLPLKQV

Conservation Score

0.982

PhyloCSF Frame 1

-4.95

No. of Spectra

3

CPC Coding Probability

0.396354

PhyloCSF Frame 2 

-5.894

CNTI Index

noncoding

Max Probability

0.9168

PhyloCSF Frame 3

-4.614

CNTI Score

-0.307422997