McDonnell Genome Institute

Washington University

Transcript

TRPM2-AS:7

Chromosome

chr21

Gene Name

TRPM2-AS

Start

44401910

CPC Label

coding

End

44425596

Cancer

OV

Strand

-

Peptide

RSLEHGDEELGR

Modified Peptide

n[145]RSLEHGDEELGR

Peptide Length

12

ORF Length

127

Open Reading Frame (ORF)

LETAWPLRPRNAAHPPTCTPAPPRRSLEHGDEELGRRGPSRPPVTARSPAGLMLLIWVTSAVTSGPEVQKEASVSSQMQVGGPGGRAAPRLARASAQGVPPTRALPGSQPGPAPGPKPGEFNLVEII

Conservation Score

1

PhyloCSF Frame 1

-4.078

No. of Spectra

1

CPC Coding Probability

0.999985

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9497

PhyloCSF Frame 3

9.273

CNTI Score

0.802135468