McDonnell Genome Institute

Washington University

Transcript

TRPM2-AS:5

Chromosome

chr21

Gene Name

TRPM2-AS

Start

44401910

CPC Label

coding

End

44425596

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

GEATHLQVSPATK

Modified Peptide

n[145]GEATHLQVSPATK

Peptide Length

13

ORF Length

86

Open Reading Frame (ORF)

LDTHWTDDNPGFTDELSLTRCGWFWARPVLIPCRAGCLRRARHRGEATHLQVSPATKSKIAPTSSLFQKSLKYKAAFFISPHSSGS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.999936

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9957

PhyloCSF Frame 3

10.957

CNTI Score

0.802135468