McDonnell Genome Institute

Washington University

Transcript

TRHDE-AS1:10

Chromosome

chr12

Gene Name

TRHDE-AS1

Start

72253507

CPC Label

noncoding

End

72258240

Cancer

OV

Strand

-

Peptide

LLFLVVDTVMMISSVLHR

Modified Peptide

n[145]LLFLVVDTVM[147]M[147]ISSVLHR

Peptide Length

18

ORF Length

68

Open Reading Frame (ORF)

LSHRLRELVTLQLRTQWTEVFRLLFLVVDTVMMISSVLHRVEVLSWDWLLVKPLRNLLRWQKLTEGQI

Conservation Score

0.381

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.172065

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9556

PhyloCSF Frame 3

0

CNTI Score

-0.367031215