McDonnell Genome Institute

Washington University

Transcript

TRG-AS1:7

Chromosome

chr7

Gene Name

TRG-AS1

Start

38331052

CPC Label

noncoding

End

38378885

Cancer

OV

Strand

+

Peptide

ILLNSIHSVNYGGPQK

Modified Peptide

n[145]ILLNSIHSVNYGGPQK

Peptide Length

16

ORF Length

34

Open Reading Frame (ORF)

LPVRKQPKILLNSIHSVNYGGPQKVIGISSSTVK

Conservation Score

0.89

PhyloCSF Frame 1

-5.862

No. of Spectra

3

CPC Coding Probability

0.156736

PhyloCSF Frame 2 

-6.315

CNTI Index

noncoding

Max Probability

0.8995

PhyloCSF Frame 3

-6.641

CNTI Score

-0.363136163