McDonnell Genome Institute

Washington University

Transcript

TRAF3IP2-AS1:10

Chromosome

chr6

Gene Name

TRAF3IP2-AS1

Start

111483554

CPC Label

noncoding

End

111598302

Cancer

OV

Strand

+

Peptide

ILVYFCLSLTGK

Modified Peptide

n[145]ILVYFCLSLTGK

Peptide Length

12

ORF Length

35

Open Reading Frame (ORF)

LFIVCKILVYFCLSLTGKQVLSYFAKGNVICAIWQ

Conservation Score

0.114

PhyloCSF Frame 1

-4.832

No. of Spectra

11

CPC Coding Probability

0.0622663

PhyloCSF Frame 2 

-5.951

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

-4.333

CNTI Score

-0.321133641