McDonnell Genome Institute

Washington University

Transcript

TPT1-AS1:66

Chromosome

chr13

Gene Name

TPT1-AS1

Start

45344418

CPC Label

noncoding

End

45395950

Cancer

CRC

Strand

+

Peptide

TSVWMLVYAIK

Modified Peptide

‚Äč

Peptide Length

11

ORF Length

91

Open Reading Frame (ORF)

LIFLQVFFSKKHAFHILSLMLKGTSVVKTSVWMLVYAIKRLMKSIQCQHTAISTNPVFICCSHPRICDEPSSEKQSETQEALLFQKLPFSE

Conservation Score

1

PhyloCSF Frame 1

-3.249

No. of Spectra

2

CPC Coding Probability

0.188243

PhyloCSF Frame 2 

-2.93

CNTI Index

coding

Max Probability

0.7442

PhyloCSF Frame 3

-2.019

CNTI Score

0.713223888