McDonnell Genome Institute

Washington University

Transcript

TPT1-AS1:26

Chromosome

chr13

Gene Name

TPT1-AS1

Start

45377742

CPC Label

coding

End

45381652

Cancer

OV

Strand

+

Peptide

ARGEEGLALSPCLVGGASPPAMGVLR

Modified Peptide

n[145]ARGEEGLALSPCLVGGASPPAM[147]GVLR

Peptide Length

26

ORF Length

90

Open Reading Frame (ORF)

MGVLRAGEDEGLALSPRLVGGASPPAMGALRARGEEGLALSPCLVGGASPPAMGVLRAWGGRGAGSQSVPGGGCLPPCDGGPESQRGKRG

Conservation Score

0.549

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.777831

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1449

PhyloCSF Frame 3

0

CNTI Score

-0.375617612