McDonnell Genome Institute

Washington University

Transcript

TP53TG1:3

Chromosome

chr7

Gene Name

TP53TG1

Start

87340974

CPC Label

noncoding

End

87345536

Cancer

OV

Strand

-

Peptide

YGESPEFLIK

Modified Peptide

n[145]YGESPEFLIK

Peptide Length

10

ORF Length

42

Open Reading Frame (ORF)

LIKVGERRYGESPEFLIKGQSQRVAGGYNLCFGQGREWRSGG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

22

CPC Coding Probability

0.136065

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9566

PhyloCSF Frame 3

0

CNTI Score

-0.364934441