McDonnell Genome Institute

Washington University

Transcript

TNKS2-AS1:11

Chromosome

chr10

Gene Name

TNKS2-AS1

Start

91782833

CPC Label

noncoding

End

91798256

Cancer

EOGC

Strand

-

Peptide

AEIGPLAPNSQVVNANEKFLKEIK

Modified Peptide

n[145]AEIGPLAPNSQVVNANEKFLKEIK

Peptide Length

24

ORF Length

92

Open Reading Frame (ORF)

LPSLSLSWGLSVPLNTIILKLGQLRTLQWFSRCSSERKSCVSLTLNQKLEMIHLSAEGMLKAEIGPLAPNSQVVNANEKFLKEIKSATPVNT

Conservation Score

0.951

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0465427

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1518

PhyloCSF Frame 3

0

CNTI Score

-0.346484315