McDonnell Genome Institute

Washington University

Transcript

TNFRSF14-AS1:29

Chromosome

chr1

Gene Name

TNFRSF14-AS1

Start

2549934

CPC Label

noncoding

End

2552052

Cancer

EOGC

Strand

-

Peptide

GATLCDSGK

Modified Peptide

n[145]GATLCDSGK

Peptide Length

9

ORF Length

82

Open Reading Frame (ORF)

MRCSVATQNEPWTHTARRMNMQTSGHVKGARPRGATLCDSGKKARSQRAQRGSEEARVPWRDAAFWEVEACGSSEIRSLRPS

Conservation Score

0.555

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0603856

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

0

CNTI Score

-0.356076906