McDonnell Genome Institute

Washington University

Transcript

TMSB15B-AS1:11

Chromosome

chrX

Gene Name

TMSB15B-AS1

Start

103917782

CPC Label

noncoding

End

103919513

Cancer

PRAD

Strand

-

Peptide

VAAAVTSLGTALPR

Modified Peptide

‚Äč

Peptide Length

14

ORF Length

77

Open Reading Frame (ORF)

LPGGPNWRVAAAVTSLGTALPRLGYLSAKHSLSRAAPGSLSGPGGASDPVPLQSYGDRKAKQSCRRGSIRCPPVERR

Conservation Score

0.906

PhyloCSF Frame 1

-2.085

No. of Spectra

1

CPC Coding Probability

0.131723

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3875

PhyloCSF Frame 3

1.432

CNTI Score

-0.316139296