McDonnell Genome Institute

Washington University

Transcript

TMPO-AS1:10

Chromosome

chr12

Gene Name

TMPO-AS1

Start

98512972

CPC Label

noncoding

End

98516454

Cancer

OV

Strand

-

Peptide

GPLAVGAGGER

Modified Peptide

n[145]GPLAVGAGGER

Peptide Length

11

ORF Length

285

Open Reading Frame (ORF)

LQAAGGPGKRRRLRAKQPPPTQLHTSQTHTSKNANPAAPTSGLSAPAPAAPRGRGDARGRRDSPAPGRPEGAPGREGLQTAASARGNRQTPAFVAPAPRPYPADGCSAPARGGGPRAEDRGGLALFVTGEVRGPLAVGAGGERRPVASREVLQDRGVFQELRHLGDLRSPLPTAFAAAAHAGALAPGRGPRCRLRASRLLPGKSAAERNKNSRTQSQARPGHKRPQSRTTNQLRPSWKLAPTPAHTLQAGGEQPASPTPQERAPPLAGDGRKRGGDWRDGSRGFH

Conservation Score

1

PhyloCSF Frame 1

0.646

No. of Spectra

1

CPC Coding Probability

0.0241826

PhyloCSF Frame 2 

8.754

CNTI Index

coding

Max Probability

0.9138

PhyloCSF Frame 3

-0.265

CNTI Score

0.770698426