McDonnell Genome Institute

Washington University

Transcript

TMEM92-AS1:4

Chromosome

chr17

Gene Name

TMEM92-AS1

Start

50281626

CPC Label

coding

End

50284853

Cancer

CCRC

Strand

-

Peptide

VISCNGGDKR

Modified Peptide

n[230]VISCNGGDKR

Peptide Length

10

ORF Length

155

Open Reading Frame (ORF)

MPLRDRQGKGPLALVTCRSLMIWTRVISCNGGDKRLLGAAQNESGEGGGGTADARRAGGLQGEFLKEEGWACYKRMIMIREGEKGSAETTAGPGPKEQEGWGPVQAGGARCSFHCALAGEGGTRGYWVASVGHGGEVCWCGCILSFSEACGGIAS

Conservation Score

0.522

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.520928

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

0

CNTI Score

-0.332436297