McDonnell Genome Institute

Washington University

Transcript

TMEM72-AS1:6

Chromosome

chr10

Gene Name

TMEM72-AS1

Start

44810766

CPC Label

noncoding

End

44959643

Cancer

OSCC

Strand

-

Peptide

GGFIMEK

Modified Peptide

n[145]GGFIMEK

Peptide Length

7

ORF Length

34

Open Reading Frame (ORF)

LEGDKYLHISFGFLVHWEHSWMSPKNRGGFIMEK

Conservation Score

0.351

PhyloCSF Frame 1

-5.61

No. of Spectra

9

CPC Coding Probability

0.168219

PhyloCSF Frame 2 

-5.166

CNTI Index

noncoding

Max Probability

0.9859

PhyloCSF Frame 3

-4.715

CNTI Score

-0.323114935