McDonnell Genome Institute

Washington University

Transcript

TMEM72-AS1:3

Chromosome

chr10

Gene Name

TMEM72-AS1

Start

44827284

CPC Label

noncoding

End

44959689

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

HEEALQLLAR

Modified Peptide

n[145]HEEALQLLAR

Peptide Length

10

ORF Length

131

Open Reading Frame (ORF)

LKHEEALQLLARSPTMGTFSGLRGQQGSRLRDLVYLSSWTPSLNILLTEEEALAAKCSPIPSCGDCEQKKNRYLQRPEPPLLFSARLSSWWSFRILVRNPEPSAGGPEDQGTRPSSQPPKACVGLIVDSKL

Conservation Score

1

PhyloCSF Frame 1

-2.823

No. of Spectra

1

CPC Coding Probability

0.134227

PhyloCSF Frame 2 

-4.061

CNTI Index

noncoding

Max Probability

0.8319

PhyloCSF Frame 3

-4.786

CNTI Score

-0.364841283