McDonnell Genome Institute

Washington University

Transcript

TMEM72-AS1:10

Chromosome

chr10

Gene Name

TMEM72-AS1

Start

44793460

CPC Label

noncoding

End

44959601

Cancer

LUAD

Strand

-

Peptide

LHQTLSEK

Modified Peptide

n[230]LHQTLSEK

Peptide Length

8

ORF Length

60

Open Reading Frame (ORF)

LDNGCGQKLWMPLLCLEYLSPHQQLLVTEPQIGSSLDLKNHCLGELCLDMSRLHQTLSEK

Conservation Score

0.044

PhyloCSF Frame 1

-5.947

No. of Spectra

2

CPC Coding Probability

0.0659331

PhyloCSF Frame 2 

-5.248

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

-4.663

CNTI Score

-0.323114935