McDonnell Genome Institute

Washington University

Transcript

TMEM51-AS1:6

Chromosome

chr1

Gene Name

TMEM51-AS1

Start

15133710

CPC Label

coding

End

15153612

Cancer

EOGC

Strand

-

Peptide

LSQLTPSARVPTR

Modified Peptide

n[145]LSQLTPSARVPTR

Peptide Length

13

ORF Length

149

Open Reading Frame (ORF)

LSQLTPSARVPTRCVVPRAPSGSHARVPAQVGPIPGSCARAMDGGALHREPALLRAHPQLCRELSRRGTGWRFPSLRVAGGQPVSARIHGGPEPPRSSGSGECKPEVGAEASHPRLCLRPLEICPRNCVALAPELGWAGFSQTAKKRGC

Conservation Score

0.947

PhyloCSF Frame 1

0.118

No. of Spectra

1

CPC Coding Probability

0.567689

PhyloCSF Frame 2 

-2.384

CNTI Index

coding

Max Probability

0.1347

PhyloCSF Frame 3

-3.197

CNTI Score

0.658139789