McDonnell Genome Institute

Washington University

Transcript

TMEM51-AS1:1

Chromosome

chr1

Gene Name

TMEM51-AS1

Start

15115952

CPC Label

noncoding

End

15152464

Cancer

LUAD

Strand

-

Peptide

LLAGLNIK

Modified Peptide

n[230]LLAGLNIK

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

LVNELRPEGLSQTGFQGCAHGIYMFLEPCWRLLAGLNIKHFFSSF

Conservation Score

0.084

PhyloCSF Frame 1

-5.114

No. of Spectra

16

CPC Coding Probability

0.190673

PhyloCSF Frame 2 

-4.496

CNTI Index

noncoding

Max Probability

0.9977

PhyloCSF Frame 3

-3.855

CNTI Score

-0.285248787