McDonnell Genome Institute

Washington University

Transcript

TMEM44-AS1:9

Chromosome

chr3

Gene Name

TMEM44-AS1

Start

194584298

CPC Label

noncoding

End

194590249

Cancer

OSCC

Strand

+

Peptide

LCLPGQTIYLDK

Modified Peptide

n[145]LCLPGQTIYLDK

Peptide Length

12

ORF Length

54

Open Reading Frame (ORF)

LCLPGQTIYLDKIIDPGMDMLSKKDALTAAHTEAESNIPILRGSSEDLEVSLSH

Conservation Score

0.043

PhyloCSF Frame 1

-4.437

No. of Spectra

1

CPC Coding Probability

0.155172

PhyloCSF Frame 2 

-4.978

CNTI Index

noncoding

Max Probability

0.9934

PhyloCSF Frame 3

-5.029

CNTI Score

-0.378735156