McDonnell Genome Institute

Washington University

Transcript

TMEM44-AS1:1

Chromosome

chr3

Gene Name

TMEM44-AS1

Start

194583998

CPC Label

noncoding

End

194587672

Cancer

OV

Strand

+

Peptide

LLPQGTPFMLLELALPLR

Modified Peptide

n[145]LLPQGTPFM[147]LLELALPLR

Peptide Length

18

ORF Length

67

Open Reading Frame (ORF)

LLPQGTPFMLLELALPLRRNWAAVAASRRRLWASPEQNCVAWHFSTSSRGRRHSVTVQGFMLAIALH

Conservation Score

0.937

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.142877

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9405

PhyloCSF Frame 3

-3.008

CNTI Score

-0.346079497