McDonnell Genome Institute

Washington University

Transcript

TMEM254-AS1:28

Chromosome

chr10

Gene Name

TMEM254-AS1

Start

80053465

CPC Label

noncoding

End

80078886

Cancer

PRAD

Strand

-

Peptide

LDLPLTSHNEVRTR

Modified Peptide

‚Äč

Peptide Length

14

ORF Length

41

Open Reading Frame (ORF)

LDLPLTSHNEVRTRRWGRGSVKPWLKFAKDKLSVLQQSFAQ

Conservation Score

0.184

PhyloCSF Frame 1

-5.203

No. of Spectra

40

CPC Coding Probability

0.174691

PhyloCSF Frame 2 

-4.843

CNTI Index

noncoding

Max Probability

0.7831

PhyloCSF Frame 3

-5.187

CNTI Score

-0.334689466