McDonnell Genome Institute

Washington University

Transcript

TMEM246-AS1:11

Chromosome

chr9

Gene Name

TMEM246-AS1

Start

101469349

CPC Label

noncoding

End

101482046

Cancer

OV

Strand

+

Peptide

RSTNLAQDLGK

Modified Peptide

n[145]RSTNLAQDLGK

Peptide Length

11

ORF Length

50

Open Reading Frame (ORF)

MRSTNLAQDLGKAMRQQIKLQRKQPPGACSYVAWKLHKRPSQNMQNSSCP

Conservation Score

0.53

PhyloCSF Frame 1

-5.405

No. of Spectra

4

CPC Coding Probability

0.0665067

PhyloCSF Frame 2 

-6.376

CNTI Index

noncoding

Max Probability

0.9264

PhyloCSF Frame 3

-5.406

CNTI Score

-0.368837337