McDonnell Genome Institute

Washington University

Transcript

TMEM212-AS1:1

Chromosome

chr3

Gene Name

TMEM212-AS1

Start

171876351

CPC Label

noncoding

End

171900740

Cancer

BRCA-Luminal B

Strand

-

Peptide

GDHFSTPTAWR

Modified Peptide

n[145]GDHFSTPTAWR

Peptide Length

11

ORF Length

112

Open Reading Frame (ORF)

LKRTSLFPPTWPHLVSGPPLCYFGVRGDHFSTPTAWRDWELHSLRNTFRAAISSQGLAAFLKLSLWSKAQAHLSETRSIILPRLVSSSWAQVILPPWPPQMLELQLLLDGFC

Conservation Score

0.24

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.00714264

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9513

PhyloCSF Frame 3

0

CNTI Score

-0.370047909