McDonnell Genome Institute

Washington University

Transcript

TMEM202-AS1:40

Chromosome

chr15

Gene Name

TMEM202-AS1

Start

72460994

CPC Label

noncoding

End

72462650

Cancer

PRAD

Strand

-

Peptide

TIFSSWGVILPMLKMCTLN

Modified Peptide

TIFSSWGVILPM[147]LKMCTLN

Peptide Length

19

ORF Length

39

Open Reading Frame (ORF)

LYVYLCFIYKTYFFSYPPKKTIFSSWGVILPMLKMCTLN

Conservation Score

0.564

PhyloCSF Frame 1

-6.465

No. of Spectra

5

CPC Coding Probability

0.0288912

PhyloCSF Frame 2 

-4.358

CNTI Index

coding

Max Probability

0.5286

PhyloCSF Frame 3

-4.825

CNTI Score

0.609117758