McDonnell Genome Institute

Washington University

Transcript

TMEM202-AS1:38

Chromosome

chr15

Gene Name

TMEM202-AS1

Start

72465127

CPC Label

noncoding

End

72466262

Cancer

HCC

Strand

-

Peptide

LAQMVVLK

Modified Peptide

n[230]LAQM[147]VVLK

Peptide Length

8

ORF Length

45

Open Reading Frame (ORF)

MISAQLKRCHKPRRLAQMVVLKEFLVMVPCACNPSYLRGCDRRVA

Conservation Score

0.691

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.0298156

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.378449831