McDonnell Genome Institute

Washington University

Transcript

TMEM132D-AS1:18

Chromosome

chr12

Gene Name

TMEM132D-AS1

Start

129109628

CPC Label

noncoding

End

129113294

Cancer

OV

Strand

+

Peptide

LGGSHGGMLLK

Modified Peptide

n[145]LGGSHGGMLLK

Peptide Length

11

ORF Length

116

Open Reading Frame (ORF)

LGGSHGGMLLKCPFCPQGPSEATWSVSEHGQGAGWLLGLHARLLYGQPLRQHFLLGCPRIPSASCSQALPARFSLLPILLSQGPDLHRILKLSLPTPSPSFLYPSQLQSSINLWCT

Conservation Score

0.26

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.148699

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9462

PhyloCSF Frame 3

0

CNTI Score

-0.368486702