McDonnell Genome Institute

Washington University

Transcript

TMCC1-AS1:11

Chromosome

chr3

Gene Name

TMCC1-AS1

Start

129893864

CPC Label

coding

End

129917223

Cancer

PRAD

Strand

+

Peptide

SLQAGLPSAAPMGPASSK

Modified Peptide

‚Äč

Peptide Length

18

ORF Length

57

Open Reading Frame (ORF)

MSLQAGLPSAAPMGPASSKACTPGDNRSTSSWHLGTLGIWPHLILPACTCCLRLFKT

Conservation Score

0.33

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.648087

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9946

PhyloCSF Frame 3

0

CNTI Score

0.689537723